PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID AA26G00386
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Aethionemeae; Aethionema
Family CAMTA
Protein Properties Length: 899aa    MW: 101560 Da    PI: 7.4949
Description CAMTA family protein
Gene Model
Gene Model ID Type Source Coding Sequence
AA26G00386genomeVEGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1CG-1164.51.8e-51311463118
        CG-1   3 kekkrwlkneeiaaiLenfekheltlelktrpksgsliLynrkkvryfrkDGyswkkkkdgktvrEdhekLKvggvevlycyYahseenptfqrrcywl 101
                 + k+rwl+++ei+aiL n +++++  ++ + p+sg++iL++rk++r+frkDG++wkkkkdg+tv+E+he+LKvg+ e +++yYah+e+nptf rrcywl
  AA26G00386  31 EAKSRWLRPNEIHAILSNPKHFTINVKPVNLPNSGRIILFDRKMLRNFRKDGHNWKKKKDGRTVKEAHEHLKVGNEERIHVYYAHGEDNPTFVRRCYWL 129
                 459************************************************************************************************ PP

        CG-1 102 Leeelekivlvhylevk 118
                 L++++e+ivlvhy+e++
  AA26G00386 130 LDKTKEHIVLVHYRETQ 146
                 **************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5143775.25425151IPR005559CG-1 DNA-binding domain
SMARTSM010761.7E-7828146IPR005559CG-1 DNA-binding domain
PfamPF038598.5E-4631144IPR005559CG-1 DNA-binding domain
SuperFamilySSF812963.5E-14364449IPR014756Immunoglobulin E-set
PfamPF127962.5E-6551629IPR020683Ankyrin repeat-containing domain
CDDcd002041.08E-15557659No hitNo description
Gene3DG3DSA:1.25.40.203.4E-16558662IPR020683Ankyrin repeat-containing domain
SuperFamilySSF484038.08E-17558667IPR020683Ankyrin repeat-containing domain
PROSITE profilePS5029715.486567632IPR020683Ankyrin repeat-containing domain
PROSITE profilePS5008811.915600632IPR002110Ankyrin repeat
SMARTSM002481.9E-5600629IPR002110Ankyrin repeat
PROSITE profilePS500966.632748772IPR000048IQ motif, EF-hand binding site
SMARTSM0001538763785IPR000048IQ motif, EF-hand binding site
SMARTSM000150.0031786808IPR000048IQ motif, EF-hand binding site
PROSITE profilePS5009610.383787811IPR000048IQ motif, EF-hand binding site
SMARTSM0001518868890IPR000048IQ motif, EF-hand binding site
PROSITE profilePS500967.675869898IPR000048IQ motif, EF-hand binding site
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0005515Molecular Functionprotein binding
Sequence ? help Back to Top
Protein Sequence    Length: 899 aa     Download sequence    Send to blast
MDGDGSLGLI GSEIHGFHTM KDLDIQTTLE EAKSRWLRPN EIHAILSNPK HFTINVKPVN  60
LPNSGRIILF DRKMLRNFRK DGHNWKKKKD GRTVKEAHEH LKVGNEERIH VYYAHGEDNP  120
TFVRRCYWLL DKTKEHIVLV HYRETQEAAL VTPGNSNSSH HSPPYLMAED IDFSTGNSDY  180
LGEKGSLGDL VCNDSPDDQN HEIRLHEINT LDWNELLLPT EFTNQSAPIV DDMSYFTEQV  240
HNSKHGSAEH GNHIIGYNTP ANPPSLNGLG DSGYLSNIQY DLGGLSQFGQ KMDSSVKAAD  300
ESLDALLNYS RQSEESSERS MNSFISDSTG SLKDPSLKAM VTSKQDPPAV FHPHSNIAEQ  360
VFSITEVSPA WAYSSEETKI LVTGFLHDSY QHLGTSNLLC VCGDSCVPAE YVQLGVYRCF  420
IPPHSPGVVN LYLSADGHSP ISQCFSFEHR SVPAPAKVSP ENDQTCKWEE FELQVRLAHL  480
LFTSSNKLNV LSSKVSPSNL REAKKLANKT SHLLNSWAYL IKAIQANKLS FDQAKDHLFE  540
LTLKNRLKEW LMEKVLEGHN TLDYDSNGLG VIHLCAILDY TWSIQLFSLS GLSLNFRDKH  600
GWTALHWAAY YGREKMVAAL LSAGARANLV TDPTKENVGG CTAADLAQQN GYDGLAAYLA  660
EKCLIAQFMD MKIAGNITGD LEAYKAEIAN QGNTMDDEQS LKDALAAYRT AAEAAARIQS  720
AFREKELKAR ASMIQFTNKE EEAKSIIAAM KIQHAFRKYE TRRKIAAASR IQCRFQTWKI  780
RREFLNMRRQ AIRIQAAFRG FQARRQYRKI IWSVGVLEKV ILRWRLKRKG FRGLQVSETA  840
EEEGPPGNDT NQTAEDFYKT SQRQAEERLE RSVVRVQAMF RSKKAQLDYR RMKLTHQEA
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006406788.10.0hypothetical protein EUTSA_v10020047mg
SwissprotQ9LSP80.0CMTA6_ARATH; Calmodulin-binding transcription activator 6
TrEMBLV4NP000.0V4NP00_EUTSA; Uncharacterized protein
STRINGfgenesh1_pm.C_scaffold_30014740.0(Arabidopsis lyrata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM40212758
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G16940.10.0calmodulin binding;transcription regulators